BINF630/BIOL580/BINF401 Spring 2026.
Homework 2.
Due May 1, 2026.

Select a protein sequence from the table according to the last digit of your G number:

Last digit
of the G number
       
      
Protein sequence
0, 1, 2

SDDSQAKRVRVLELSRRLRHRGPDWSGLYQNGDNYLAHQRLAVIDPASGDQPLFNEDKTI
VVTVNGEIYNHEELRKRLKNHKFRTGSDCEVIAHLYEEYGVDFVDMLDGIFSFVLLDTRD
____________________________________________________________
3, 4, 5

SQEELEEGKSSLVQSLDGDWLIDYAENGQGPVNFYAEDFDDSNFKSVKVPGNLELQGFGQ
PQYVNVQYPWDGSEEIFPPQIPSKNPLASYVRYFDLDEAFWDKEVSLKFDGAATAIYVWL
____________________________________________________________
6, 7, 8, 9

LRANKSTSAFGLEARVPFLDKDFINTAMSLDPESKMIKPEEGRIEKWVLRRAFDDEERPY
LPKHILYRQKEQFSDGVGYSWIDGLKDHAAQNVNDKMMSNAGHIFPHNTPNTKEAYYYRM
____________________________________________________________


1. Identify the source of your sequence and the location of the fragment represented by this sequence in the protein.

2. Check if an experimentally determined three-dimensional structure of your fragment is known.

3. Predict secondary structure for your sequence.

4. Find two best structural templates (from different species) for the homology modeling of your sequence.

5. Find three-dimensional structural model for your sequence.

6. Analyze the quality of your model using one of the structure assessment tools.

7. Create a visualization of your model highlighting and annotating one of the important molecular or biological features.

8. FOR BINF630 AND BIOL580 STUDENTS ONLY: Compare predicted secondary structure (Q3) with the secondary structure in 3D model (Q5) and interpret the results.


The report should be submitted by email to both instructors as a Word or PDF file with the filename "b630_26_hw2_Your_Name.doc or .pdf". The string "b630_26_hw2" should be also included in the message subject line.